Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PITPNA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-270 of human PITPNA (NP_006215.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PITPNA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-270 of human PITPNA (NP_006215.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03357A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PITPNA |
| Target Synonyms | PITPN; VIB1A; HEL-S-36; PI-TPalpha; PITPNA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Rat heart, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 211-270 of human PITPNA (NP_006215.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD | Uniprot ID | Q00169 |
Uniprot Id
Q00169
Target Species
Human
Target Name
PITPNA
Target Full Name
Phosphatidylinositol transfer protein alpha isoform
Target Function
Catalyzes the transfer of phosphatidylinositol (PI) and phosphatidylcholine (PC) between membranes. Shows a preference for PI and PC containing shorter saturated or monosaturated acyl chains at the sn-1 and sn-2 positions. Preference order for PC is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 and for PI is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
PtdIns transfer protein family, PI transfer class I subfamily
Target Synonyms
MGC99649; Phosphatidylinositol transfer protein alpha; Phosphatidylinositol transfer protein alpha isoform; Phosphotidylinositol transfer protein; PI-TP-alpha; PIPNA_HUMAN; PITP alpha; Pitpna; PITPNB; PtdIns transfer protein alpha; PtdInsTP alpha; PtdInsTP; Vb; VIB1A; Vibrator
Target Background
This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3, 4, 5-trisphosphate (PIP3) by phosphoinositide-3-kinase.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
