Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Pituitary homeobox 2 (PITX2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pituitary homeobox 2 (PITX2) (NP_700475.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Pituitary homeobox 2 (PITX2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pituitary homeobox 2 (PITX2) (NP_700475.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14802A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pituitary homeobox 2 (PITX2) |
| Target Synonyms | RS; RGS; ARP1; Brx1; IDG2; IGDS; IHG2; PTX2; RIEG; ASGD4; IGDS2; IRID2; Otlx2; RIEG1; Pituitary homeobox 2 (PITX2) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pituitary homeobox 2 (PITX2) (NP_700475.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQEL | Uniprot ID | Q99697 |
Uniprot Id
Q99697
Target Species
Human
Target Name
PITX2
Target Full Name
Pituitary homeobox 2
Target Function
Controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, exerts a role in the expansion of muscle progenitors. May play a role in the proper localization of asymmetric organs such as the heart and stomach. Isoform PTX2C is involved in left-right asymmetry the developing embryo.
Target Involvement
Axenfeld-Rieger syndrome 1 (RIEG1); Anterior segment dysgenesis 4 (ASGD4); Ring dermoid of cornea (RDC)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family, Bicoid subfamily
Target Synonyms
All1 responsive gene 1; ALL1 responsive protein ARP1; ALL1-responsive protein ARP1; ARP 1; ARP1; Brx 1; Brx1; Homeobox protein PITX2; IDG 2; IDG2; IGDS 2; IGDS; IGDS2; IHG 2; IHG2; IRID 2; IRID2; MGC111022; MGC20144; Otlx 2; Otlx2; Paired like homeodomain transcription factor 2; Paired-like homeodomain transcription factor 2; Pituitary homeo box 2; Pituitary homeobox 2; PITX 2; pitx2; PITX2_HUMAN; PTX 2; PTX2; RGS; RIEG 1; RIEG; Rieg bicoid related homeobox transcription factor 1; RIEG bicoid related homeobox transcription factor; RIEG bicoid-related homeobox transcription factor; RIEG1; RS; Solurshin
Target Background
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
