-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PITX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PITX3 (NP_005020.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PITX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PITX3 (NP_005020.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01635A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PITX3 |
| Target Synonyms | ASMD; ASOD; PTX3; ASGD1; CTPP4; CTRCT11; PITX3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, 293T, Rat kidney, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PITX3 (NP_005020.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFT | Uniprot ID | O75364 |
Uniprot Id
O75364
Target Species
Human
Target Name
PITX3
Target Full Name
Pituitary homeobox 3
Target Function
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. In addition to its importance during development, it also has roles in the long-term survival and maintenance of the mdDA neurons. Activates NR4A2/NURR1-mediated transcription of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons. Acts by decreasing the interaction of NR4A2/NURR1 with the corepressor NCOR2/SMRT which acts through histone deacetylases (HDACs) to keep promoters of NR4A2/NURR1 target genes in a repressed deacetylated state. Essential for the normal lens development and differentiation. Plays a critical role in the maintenance of mitotic activity of lens epithelial cells, fiber cell differentiation and in the control of the temporal and spatial activation of fiber cell-specific crystallins. Positively regulates FOXE3 expression and negatively regulates PROX1 in the anterior lens epithelium, preventing activation of CDKN1B/P27Kip1 and CDKN1C/P57Kip2 and thus maintains lens epithelial cells in cell cycle.
Target Involvement
Anterior segment dysgenesis 1 (ASGD1); Cataract 11, multiple types (CTRCT11)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family, Bicoid subfamily
Target Tissue Specificity
Highly expressed in developing eye lens.
Target Synonyms
Homeobox protein PITX 3; Homeobox protein PITX3; MGC12766; Paired like homeodomain transcription factor 3; Paired-like homeodomain transcription factor 3; Pituitary homeobox 3; PITX 3; Pitx3; PITX3_HUMAN; PTX 3; PTX3
Target Background
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.
Notification