-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIWIL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 272-383 of human PIWIL4 (NP_689644.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PIWIL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 272-383 of human PIWIL4 (NP_689644.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15438A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIWIL4 |
| Target Synonyms | HIWI2; MIWI2; PIWIL4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse testis, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 272-383 of human PIWIL4 (NP_689644.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVLEFMTALCQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDNSEAQLAHLIPELCFLT | Uniprot ID | Q7Z3Z4 |
Uniprot Id
Q7Z3Z4
Target Species
Human
Target Name
PIWIL4
Target Full Name
Piwi-like protein 4
Target Function
Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Associates with secondary piRNAs antisense and PIWIL2/MILI is required for such association. The piRNA process acts upstream of known mediators of DNA methylation. Does not show endonuclease activity. Plays a key role in the piRNA amplification loop, also named ping-pong amplification cycle, by acting as a 'slicer-incompetent' component that loads cleaved piRNAs from the 'slicer-competent' component PIWIL2 and target them on genomic transposon loci in the nucleus. May be involved in the chromatin-modifying pathway by inducing 'Lys-9' methylation of histone H3 at some loci. In addition to its role in germline, PIWIL4 also plays a role in the regulation of somatic cells activities. Plays a role in pancreatic beta cell function and insulin secretion. Involved in maintaining cell morphology and functional integrity of retinal epithelial through Akt/GSK3alpha/beta signaling pathway. When overexpressed, acts as an oncogene by inhibition of apoptosis and promotion of cells proliferation in tumors.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Argonaute family, Piwi subfamily
Target Tissue Specificity
Ubiquitously expressed. Detected in retina, retinal pigment epithelia cells (RPE) (at protein level).
Target Synonyms
DKFZp686P01248; FLJ36156; HILI 2; HILI2 ; HIWI 2; HIWI2; Miwi 2 protein; Miwi2; PIWI; Piwi like 2; Piwi like 4 (Drosophila) ; Piwi like 4; Piwi like protein 4; PIWI like protein; Piwi like RNA mediated gene silencing 4; Piwi-like protein 4; PIWIL 4; Piwil4; PIWL4_HUMAN
Target Background
PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).
Notification