Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PKNOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 322-436 of human PKNOX1 (NP_004562.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PKNOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 322-436 of human PKNOX1 (NP_004562.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05152A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PKNOX1 |
| Target Synonyms | PREP1; pkonx1c; PKNOX1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 322-436 of human PKNOX1 (NP_004562.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALAPAHISGLVLENSDSLQ | Uniprot ID | P55347 |
Uniprot Id
P55347
Target Species
Human
Target Name
PKNOX1
Target Full Name
Homeobox protein PKNOX1
Target Function
Activates transcription in the presence of PBX1A and HOXA1.
Target Subcellular Location
Nucleus.
Target Protein Families
TALE/MEIS homeobox family
Target Tissue Specificity
Ubiquitous. Isoform 2 is expressed in all examined tissues except in bone marrow.
Target Synonyms
Homeobox protein PKNOX1; Homeobox protein PREP-1; Human homeobox containing protein ; Pbx regulating protein 1; PBX/knotted 1 homeobox 1; PBX/knotted homeobox 1; Pknox1; PKNX1_HUMAN; pkonx1c; PREP1
Target Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in angiogenesis and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within camera-type eye development; hemopoiesis; and positive regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm and nucleus. Predicted to be part of chromatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
