Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLA2G4D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-680 of human PLA2G4D (NP_828848.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against PLA2G4D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-680 of human PLA2G4D (NP_828848.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of Hela cells using PLA2G4D Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-05205A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLA2G4D |
| Target Synonyms | cPLA2delta; PLA2G4D | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-680 of human PLA2G4D (NP_828848.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPF | Uniprot ID | Q86XP0 |
Uniprot Id
Q86XP0
Target Species
Human
Target Name
PLA2G4D
Target Full Name
Cytosolic phospholipase A2 delta
Target Function
Calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position. Has a preference for linoleic acid at the sn-2 position.
Target Subcellular Location
Cytoplasm, cytosol. Membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Expressed in stratified squamous epithelia, such as those in skin and cervix, but not in other tissues. Strongly expressed in the upper spinous layer of the psoriatic epidermis, expressed weakly and discontinuously in atopic dermatitis and mycosis fungoid
Target Synonyms
cPLA2 delta; cPLA2-delta; cPLA2delta; Cytosolic phospholipase A2 delta; PA24D_HUMAN; Phospholipase A2 group IVD; phospholipase A2; group IVD (cytosolic); Pla2g4d
Target Background
The phospholipase A2 enzyme family, including PLA2G4D, catalyze the hydrolysis of glycerophospholipids at the sn-2 position and then liberate free fatty acids and lysophospholipids (Chiba et al., 2004 [PubMed 14709560]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
