Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Placental alkaline phosphatase (PLAP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Placental alkaline phosphatase (PLAP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13849A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Placental alkaline phosphatase (PLAP) |
| Target Synonyms | ALP; IAP; ALPI; PALP; PLAP; PLAP-1; Placental alkaline phosphatase (PLAP) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, PC-3 cells | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA | Uniprot ID | P05187 |
Uniprot Id
P05187
Target Species
Human
Target Name
ALPP
Target Full Name
Alkaline phosphatase, placental type
Target Function
Alkaline phosphatase that can hydrolyze various phosphate compounds.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Alkaline phosphatase family
Target Tissue Specificity
Detected in placenta (at protein level).
Target Research Area
Tags & Cell Markers
Target Synonyms
ALPP; PLAP; Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1
Target Background
The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
