-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLOD2/LH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human PLOD2/LH2 (NP_000926.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLOD2/LH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human PLOD2/LH2 (NP_000926.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12554A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLOD2/LH2 |
| Target Synonyms | LH2; TLH; BRKS2; PLOD2/LH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, Molt-4, Mouse uterus, Rat uterus, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human PLOD2/LH2 (NP_000926.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSIGVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKAKHEIKTIKIVGPEENLSQAEARNMGMDFCR | Uniprot ID | O00469 |
Uniprot Id
O00469
Target Species
Human
Target Name
PLOD2
Target Full Name
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
Target Function
Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.
Target Involvement
Bruck syndrome 2 (BRKS2)
Target Subcellular Location
Rough endoplasmic reticulum membrane; Peripheral membrane protein; Lumenal side.
Target Tissue Specificity
Highly expressed in pancreas and muscle. Isoform 1 and isoform 2 are expressed in the majority of the examined cell types. Isoform 2 is specifically expressed in skin, lung, dura and aorta.
Target Research Area
Cancer
Target Synonyms
2-oxoglutarate 5-dioxygenase 2; LH2; Lysine hydroxylase 2; Lysyl hydroxylase 2; OTTHUMP00000215204; OTTHUMP00000215205; OTTHUMP00000215206; PLOD 2; Plod2; PLOD2_HUMAN; Procollagen lysine 2 oxoglutarate 5 dioxygenase 2; Procollagen lysine; 2 oxoglutarate 5 dioxygenase (lysine hydroxylase) 2; Procollagen-lysine; Telopeptide lysyl hydroxylase; TLH
Target Background
The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. Mutations in the coding region of this gene are associated with Bruck syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification