Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PMPCA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 456-525 of human PMPCA (NP_055975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PMPCA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 456-525 of human PMPCA (NP_055975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00842A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PMPCA |
| Target Synonyms | CLA1; CPD3; MAS2; P-55; SCAR2; INPP5E; Alpha-MPP; PMPCA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, MCF7, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 456-525 of human PMPCA (NP_055975.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR | Uniprot ID | Q10713 |
Uniprot Id
Q10713
Target Species
Human
Target Name
PMPCA
Target Full Name
Mitochondrial-processing peptidase subunit alpha
Target Function
Substrate recognition and binding subunit of the essential mitochondrial processing protease (MPP), which cleaves the mitochondrial sequence off newly imported precursors proteins.
Target Involvement
Spinocerebellar ataxia, autosomal recessive, 2 (SCAR2)
Target Subcellular Location
Mitochondrion matrix. Mitochondrion inner membrane.
Target Protein Families
Peptidase M16 family
Target Tissue Specificity
Ubiquitously expressed with highest expression in fetal tissues and adult brain, cerebellum and cerebellar vermis.
Target Synonyms
1200002L24Rik; 4933435E07Rik; Alpha MPP; Alpha-MPP; FLJ26258; Inositol polyphosphate 5 phosphatase, 72 kD; INPP5E; KIAA0123; MGC104197; MGC93916; Mitochondrial matrix processing protease, alpha subunit; mitochondrial processing peptidase subunit alpha; Mitochondrial-processing peptidase subunit alpha; MPPA_HUMAN; P 55; P-55; Peptidase (mitochondrial processing) alpha; pmpca; RP11-413M3.1; RP23-306D20.8; SCAR2
Target Background
The protein encoded by this gene is found in the mitochondrion, where it represents the alpha subunit of a proteolytic heterodimer. This heterodimer is responsible for cleaving the transit peptide from nuclear-encoded mitochondrial proteins. Defects in this gene are a cause of spinocerebellar ataxia, autosomal recessive 2.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
