Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PMVK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human PMVK (NP_006547.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PMVK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human PMVK (NP_006547.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05982A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PMVK |
| Target Synonyms | PMK; PMKA; PMKASE; POROK1; HUMPMKI; PMVK | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-431, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human PMVK (NP_006547.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL | Uniprot ID | Q15126 |
Uniprot Id
Q15126
Target Species
Human
Target Name
PMVK
Target Full Name
Phosphomevalonate kinase
Target Function
Catalyzes the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate to produce mevalonate diphosphate and ADP, a key step in the mevalonic acid mediated biosynthesis of isopentenyl diphosphate and other polyisoprenoid metabolites.
Target Involvement
Porokeratosis 1, multiple types (POROK1)
Target Subcellular Location
Cytoplasm, cytosol.
Target Tissue Specificity
Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
Target Synonyms
hPMK; HUMPMKI; OTTHUMP00000035546; Phosphomevalonate kinase; PMK; PMK PEN; PMKA; PMKase; PMKI; PMKPEN; PMVK; PMVK_HUMAN
Target Background
This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate to mevalonate 5-diphosphate, which is the fifth step in the mevalonate pathway of isoprenoid biosynthesis. Mutations in this gene are linked to certain types of porokeratosis including disseminated superficial porokeratosis. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
