Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PNMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 183-282 of human PNMT (P11086) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PNMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 183-282 of human PNMT (P11086) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14495A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PNMT |
| Target Synonyms | PENT; PNMTase; PNMT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, K-562, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 183-282 of human PNMT (P11086). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL | Uniprot ID | P11086 |
Uniprot Id
P11086
Target Species
Human
Target Name
PNMT
Target Full Name
Phenylethanolamine N-methyltransferase
Target Function
Converts noradrenaline to adrenaline.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Target Synonyms
Noradrenaline N-methyltransferase; PENT; Phenylethanolamine N-methyltransferase; PNMT; PNMT_HUMAN; PNMTase
Target Background
The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
