Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLE4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human POLE4 (NP_063949.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLE4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human POLE4 (NP_063949.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10861A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLE4 |
| Target Synonyms | p12; YHHQ1; POLE4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2, HL-60, MCF-7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human POLE4 (NP_063949.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD | Uniprot ID | Q9NR33 |
Uniprot Id
Q9NR33
Target Species
Human
Target Name
POLE4
Target Full Name
DNA polymerase epsilon subunit 4
Target Function
Accessory component of the DNA polymerase epsilon complex. Participates in DNA repair and in chromosomal DNA replication.
Target Subcellular Location
Nucleus.
Target Synonyms
DNA polymerase epsilon 4 accessory subunit; DNA polymerase epsilon p12 subunit; DNA polymerase epsilon subunit 4; DNA polymerase epsilon subunit p12; DNA polymerase II subunit 4; DPOE4_HUMAN; p12; POLE4; Polymerase (DNA directed) epsilon 4 (p12 subunit); Polymerase (DNA directed) epsilon 4; YHHQ1
Target Background
POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
