-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02105A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLK |
| Target Synonyms | DINP; POLQ; DINB1; POLK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, Rat heart, 22Rv1, Mouse brain, Mouse liver, SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS | Uniprot ID | Q9UBT6 |
Uniprot Id
Q9UBT6
Target Species
Human
Target Name
POLK
Target Full Name
DNA polymerase kappa
Target Function
DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity.
Target Subcellular Location
Nucleus.
Target Protein Families
DNA polymerase type-Y family
Target Tissue Specificity
Detected at low levels in testis, spleen, prostate and ovary. Detected at very low levels in kidney, colon, brain, heart, liver, lung, placenta, pancreas and peripheral blood leukocytes.
Target Synonyms
DinB homolog 1 (E. coli); DINB protein; DINB1; DINP; DNA damage inducible protein b; DNA polymerase kappa; Polk; POLK_HUMAN; POLQ; Polymerase (DNA directed) kappa; polymerase, DNA, kappa
Target Background
This gene encodes a member of the DNA polymerase type-Y family of proteins. The encoded protein is a specialized DNA polymerase that catalyzes translesion DNA synthesis, which allows DNA replication in the presence of DNA lesions. Human cell lines lacking a functional copy of this gene exhibit impaired genome integrity and enhanced susceptibility to oxidative damage. Mutations in this gene that impair enzyme activity may be associated with prostate cancer in human patients.
Notification