Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR2H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human POLR2H (NP_006223.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against POLR2H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human POLR2H (NP_006223.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-03590A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR2H |
| Target Synonyms | RPB8; RPB17; RPABC3; POLR2H | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HL-60, MCF7, Mouse spleen, Mouse thymus, SW480 | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human POLR2H (NP_006223.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF | Uniprot ID | P52434 |
Uniprot Id
P52434
Target Species
Human
Target Name
POLR2H
Target Full Name
DNA-directed RNA polymerases I, II, and III subunit RPABC3
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Eukaryotic RPB8 RNA polymerase subunit family
Target Synonyms
POLR2H; DNA-directed RNA polymerases I; II; and III subunit RPABC3; RNA polymerases I; II; and III subunit ABC3; DNA-directed RNA polymerase II subunit H; DNA-directed RNA polymerases I; II; and III 17.1 kDa polypeptide; RPB17; RPB8 homolog; hRPB8
Target Background
The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
