Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR3K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLR3K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03005A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR3K |
| Target Synonyms | C11; HLD21; My010; RPC10; RPC11; RPC12.5; C11-RNP3; POLR3K | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD | Uniprot ID | Q9Y2Y1 |
Uniprot Id
Q9Y2Y1
Target Species
Human
Target Name
POLR3K
Target Full Name
DNA-directed RNA polymerase III subunit RPC10
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family
Target Research Area
Immunology
Target Synonyms
C11; C11 RNP3; DNA directed RNA polymerase III subunit K; DNA directed RNA polymerase III subunit RPC10; DNA directed RNA polymerases III 12.5 kDa polypeptide; DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerase III subunit RPC10; hRPC11; HsC11p; My010; POLR3K; Polymerase (RNA) III (DNA directed) polypeptide K; Polymerase (RNA) III (DNA directed) polypeptide K; 12.3 kDa; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit (hRPC11); RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RPC10; RPC10_HUMAN; RPC11; RPC12.5
Target Background
This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
