Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POMGNT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-340 of human POMGNT2 (NP_116195.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POMGNT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-340 of human POMGNT2 (NP_116195.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05589A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POMGNT2 |
| Target Synonyms | AGO61; GTDC2; MDDGA8; MDDGC8; C3orf39; POMGNT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-549, BxPC-3, Mouse brain, Mouse ovary, Mouse pancreas, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-340 of human POMGNT2 (NP_116195.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASM | Uniprot ID | Q8NAT1 |
Uniprot Id
Q8NAT1
Target Species
Human
Target Name
POMGNT2
Target Full Name
Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
Target Function
O-linked mannose beta-1,4-N-acetylglucosaminyltransferase that transfers UDP-N-acetyl-D-glucosamine to the 4-position of the mannose to generate N-acetyl-D-glucosamine-beta-1,4-O-D-mannosylprotein. Involved in the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity.
Target Involvement
Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A8 (MDDGA8)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 61 family
Target Tissue Specificity
Highly expressed in the brain, muscle, heart, and kidney in both fetus and adult. In the brain, highest expression in the cortex and cerebellum. Highly expressed in the pancreas.
Target Synonyms
POMGNT2; AGO61; C3orf39; EOGTL; GTDC2; Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2; POMGnT2; EC 2.4.1.312; Extracellular O-linked N-acetylglucosamine transferase-like; Glycosyltransferase-like domain-containing protein 2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
