-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-141 of human POMP (NP_057016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-141 of human POMP (NP_057016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01053A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POMP |
| Target Synonyms | UMP1; PRAAS2; HSPC014; C13orf12; PNAS-110; POMP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-141 of human POMP (NP_057016.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL | Uniprot ID | Q9Y244 |
Uniprot Id
Q9Y244
Target Species
Human
Target Name
POMP
Target Full Name
Proteasome maturation protein
Target Function
Molecular chaperone essential for the assembly of standard proteasomes and immunoproteasomes. Degraded after completion of proteasome maturation. Mediates the association of 20S preproteasome with the endoplasmic reticulum.
Target Involvement
Keratosis linearis with ichthyosis congenita and sclerosing keratoderma (KLICK)
Target Subcellular Location
Cytoplasm, cytosol. Nucleus. Microsome membrane.
Target Protein Families
POMP/UMP1 family
Target Tissue Specificity
Strongly expressed from the basal layer to the granular layer of healthy epidermis, whereas in KLICK patients there is a gradual decrease of expression toward the granular layer.
Target Synonyms
2510048O06Rik; C13orf12; Chromosome 13 open reading frame 12 ; HSPC 014; HSPC036 protein ; hUMP 1; hUMP1; PNAS 110; PNAS110; Pomp; POMP_HUMAN; Proteasome maturation protein; Proteassemblin; Protein UMP1 homolog; UMP 1; UMP1; UMP1; yeast; homolog of; Voltage gated K channel beta subunit 4.1 ; Voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1
Target Background
The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.
Notification