-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PORCN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PORCN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02181A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PORCN |
| Target Synonyms | PPN; DHOF; FODH; MG61; PORC; PORCN | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG | Uniprot ID | Q9H237 |
Uniprot Id
Q9H237
Target Species
Human
Target Name
PORCN
Target Full Name
Protein-serine O-palmitoleoyltransferase porcupine
Target Function
Protein-serine O-palmitoleoyltransferase that acts as a key regulator of the Wnt signaling pathway by mediating the attachment of palmitoleate, a 16-carbon monounsaturated fatty acid (C16:1), to Wnt proteins. Serine palmitoleylation of WNT proteins is required for efficient binding to frizzled receptors.
Target Involvement
Focal dermal hypoplasia (FODH)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Membrane-bound acyltransferase family, Porcupine subfamily
Target Tissue Specificity
Isoform 1 is expressed in fetal brain, brain, amygdala, caudate nucleus, cerebellum, hippocampus, pituitary, thalamus, heart, skeletal muscle and testis. Isoform 4 is expressed in amygdala, corpus callosum, hippocampus, spinal cord, kidney, liver, lung, s
Target Research Area
Stem Cells
Target Synonyms
DHOF; FODH; MG61; MGC29687; por; PORC; PORCN; PORCN_HUMAN; PPN; Probable protein-cysteine N-palmitoyltransferase porcupine; Protein MG61
Target Background
This gene belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the porcupine family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Disruption of this gene is associated with focal dermal hypoplasia, and the encoded protein has been implicated in cancer. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
Notification