Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POU3F4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human POU3F4 (NP_000298.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POU3F4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human POU3F4 (NP_000298.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with POU3F4, using POU3F4 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 0.5s.
| Cat.No | ADA-10498A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POU3F4 |
| Target Synonyms | BRN4; DFN3; OTF9; BRN-4; DFNX2; OCT-9; OTF-9; BRAIN-4; POU3F4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F transfected with POU3F4 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human POU3F4 (NP_000298.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPT | Uniprot ID | P49335 |
Uniprot Id
P49335
Target Species
Human
Target Name
POU3F4
Target Full Name
POU domain, class 3, transcription factor 4
Target Function
Probable transcription factor which exert its primary action widely during early neural development and in a very limited set of neurons in the mature brain.
Target Involvement
Deafness, X-linked, 2 (DFNX2)
Target Subcellular Location
Nucleus.
Target Protein Families
POU transcription factor family, Class-3 subfamily
Target Tissue Specificity
Brain specific.
Target Synonyms
Brain specific homeobox POU domain protein 4; Brain-4; Brain-specific homeobox/POU domain protein 4; BRAIN4; Brn-4; BRN4; class 3; DFN3; DFNX2; Oct-9; Octamer-binding protein 9; Octamer-binding transcription factor 9; OTF-9; OTF9; PO3F4_HUMAN; POU class 3 homeobox 4; POU domain; POU domain class 3 transcription factor 4; Pou3f4; transcription factor 4
Target Background
This gene encodes a member of the POU-III class of neural transcription factors. This family member plays a role in inner ear development. The protein is thought to be involved in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations in this gene are associated with X chromosome-linked nonsyndromic mixed deafness.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
