-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPFIA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human PPFIA1 (NP_003617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPFIA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human PPFIA1 (NP_003617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09051A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPFIA1 |
| Target Synonyms | LIP1; LIP.1; LIPRIN; PPFIA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, DU145, MCF7, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human PPFIA1 (NP_003617.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRSTPRRIPHSPAREVDRLGVMTLLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDIRNSTGSQDGPVSNPSSSNSSQDSLHKAPKK | Uniprot ID | Q13136 |
Uniprot Id
Q13136
Target Species
Human
Target Name
PPFIA1
Target Full Name
Liprin-alpha-1
Target Function
May regulate the disassembly of focal adhesions. May localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates.
Target Subcellular Location
Cytoplasm. Note=Colocalizes with PTPRF at the ends of focal adhesions most proximal to the cell nucleus.
Target Protein Families
Liprin family, Liprin-alpha subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
FLJ42630; HGNC:9245; LAR interacting protein 1; LAR-interacting protein 1; LIP 1; LIP-1; LIP.1; LIP1; LIPA1_HUMAN; Liprin alpha 1; LIPRIN; Liprin-alpha-1; MGC26800; PPFIA 1; PPFIA1; Protein tyrosine phosphatase receptor type f polypeptide (PTPRF) interacting protein (liprin) alpha 1; Protein tyrosine phosphatase receptor type f polypeptide interacting protein alpha 1; Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1; PTPRF interacting protein alpha 1; PTPRF-interacting protein alpha-1
Target Background
The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. This protein binds to the intracellular membrane-distal phosphatase domain of tyrosine phosphatase LAR, and appears to localize LAR to cell focal adhesions. This interaction may regulate the disassembly of focal adhesion and thus help orchestrate cell-matrix interactions. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Notification