Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPIL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human PPIL1 (NP_057143.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPIL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human PPIL1 (NP_057143.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05395A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPIL1 |
| Target Synonyms | CYPL1; PCH14; hCyPX; PPIase; CGI-124; PPIL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, Mouse brain, Mouse liver, Raji, Rat lung, Rat spleen, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human PPIL1 (NP_057143.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG | Uniprot ID | Q9Y3C6 |
Uniprot Id
Q9Y3C6
Target Species
Human
Target Name
PPIL1
Target Full Name
Peptidyl-prolyl cis-trans isomerase-like 1
Target Function
Involved in pre-mRNA splicing as component of the spliceosome. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Target Subcellular Location
Nucleus.
Target Protein Families
Cyclophilin-type PPIase family, PPIL1 subfamily
Target Tissue Specificity
Ubiquitous, with the most abundant expression in heart and skeletal muscle.
Target Synonyms
CYPL1; PCH14; hCyPX; PPIase; CGI-124; PPIL1
Target Background
This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
