Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PPL (NP_002696.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PPL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PPL (NP_002696.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05865A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPL |
| Target Synonyms | PPL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PPL (NP_002696.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVK | Uniprot ID | O60437 |
Uniprot Id
O60437
Target Species
Human
Target Name
PPL
Target Full Name
Periplakin
Target Function
Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling.
Target Subcellular Location
Cell junction, desmosome. Cytoplasm, cytoskeleton. Cell membrane. Cytoplasm.
Target Protein Families
Plakin or cytolinker family
Target Tissue Specificity
Expressed in stratified squamous epithelia and in some other epithelia.
Target Synonyms
190 kDa paraneoplastic pemphigus antigen; 195 kDa cornified envelope precursor; 195 kDa cornified envelope precursor protein; AW553870; KIAA0568; MGC134872 ; PEPL_HUMAN; Periplakin; ppl
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
