Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPM1E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPM1E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13201A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPM1E |
| Target Synonyms | POPX1; PP2CH; caMKN; CAMKPN; CaMKP-N; PPM1E | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKA | Uniprot ID | Q8WY54 |
Uniprot Id
Q8WY54
Target Species
Human
Target Name
PPM1E
Target Full Name
Protein phosphatase 1E
Target Function
Protein phosphatase that inactivates multifunctional CaM kinases such as CAMK4 and CAMK2. Dephosphorylates and inactivates PAK. May play a role in the inhibition of actin fiber stress breakdown and in morphological changes driven by TNK2/CDC42. Dephosphorylates PRKAA2.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
PP2C family
Target Synonyms
Ca(2+)/calmodulin-dependent protein kinase phosphatase N; CaMKN; CaMKP-N; CaMKP-nucleus; KIAA1072; Nuclear calmodulin dependent protein kinase phosphatase; Partner of PIX 1; Partner of PIX-alpha; Partner of PIXA; POPX1; PP2CH; Ppm1e; PPM1E_HUMAN; Protein phosphatase 1E; Protein phosphatase Mg2+/Mn2+ dependent 1E
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
