Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPME1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human PPME1 (NP_057231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPME1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human PPME1 (NP_057231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03425A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPME1 |
| Target Synonyms | PME-1; ABDH19; PPME1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human PPME1 (NP_057231.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGA | Uniprot ID | Q9Y570 |
Uniprot Id
Q9Y570
Target Species
Human
Target Name
PPME1
Target Full Name
Protein phosphatase methylesterase 1
Target Function
Demethylates proteins that have been reversibly carboxymethylated. Demethylates PPP2CB (in vitro) and PPP2CA. Binding to PPP2CA displaces the manganese ion and inactivates the enzyme.
Target Protein Families
AB hydrolase superfamily
Target Synonyms
PME 1; PME-1; PME1; PPME1; PPME1_HUMAN; Protein phosphatase methylesterase 1; Testicular Secretory Protein Li 39
Target Background
This gene encodes a protein phosphatase methylesterase localized to the nucleus. The encoded protein acts on the protein phosphatase-2A catalytic subunit and supports the ERK pathway through dephosphorylation of regulatory proteins. It plays a role in malignant glioma progression. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
