Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP1R14B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPP1R14B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10179A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP1R14B |
| Target Synonyms | PNG; PHI-1; PLCB3N; SOM172; PPP1R14B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK | Uniprot ID | Q96C90 |
Uniprot Id
Q96C90
Target Species
Human
Target Name
PPP1R14B
Target Full Name
Protein phosphatase 1 regulatory subunit 14B
Target Function
Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated.
Target Subcellular Location
Cytoplasm.
Target Protein Families
PP1 inhibitor family
Target Tissue Specificity
Ubiquitous. Expressed at low levels.
Target Synonyms
PHI 1; PHI1; Phospholipase C beta 3 neighboring gene protein; Phospholipase C beta 3 neighbouring gene protein; Phospholipase C-beta-3 neighbouring gene protein; PLCB3N; PNG ; PP14B_HUMAN; Ppp1r14b; Protein phosphatase 1 regulatory (inhibitor) subunit 14B; Protein phosphatase 1 regulatory subunit 14B; SOM172
Target Background
Predicted to enable protein serine/threonine phosphatase inhibitor activity. Predicted to be involved in innate immune response. Predicted to be located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
