-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP6C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 206-305 of human PPP6C (O00743) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPP6C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 206-305 of human PPP6C (O00743) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13199A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP6C |
| Target Synonyms | PP6; PP6C; PPP6C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-549, Mouse brain, Mouse spleen, Rat lung, RD | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 206-305 of human PPP6C (O00743). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL | Uniprot ID | O00743 |
Uniprot Id
O00743
Target Species
Human
Target Name
PPP6C
Target Full Name
Serine/threonine-protein phosphatase 6 catalytic subunit
Target Function
Catalytic subunit of protein phosphatase 6 (PP6). PP6 is a component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation. N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1. During mitosis, regulates spindle positioning. Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7. Participates also in the innate immune defense against viruses by desphosphorylating RIG-I/DDX58, an essential step that triggers RIG-I/DDX58-mediated signaling activation.
Target Subcellular Location
Mitochondrion. Cytoplasm.
Target Protein Families
PPP phosphatase family, PP-6 (PP-V) subfamily
Target Tissue Specificity
Ubiquitously expressed in all tissues tested with highest expression levels in testis, heart, kidney, brain, stomach, liver and skeletal muscle and lowest in placenta, lung colon and spleen.
Target Synonyms
FLJ92648; MGC12249; PP 6; PP6; PP6C; PPP 6; PPP 6C; PPP6; PPP6_HUMAN; Ppp6c; Protein phosphatase 6 catalytic subunit; Serine/threonine protein phosphatase 6; Serine/threonine protein phosphatase catalytic subunit ; Serine/threonine-protein phosphatase 6 catalytic subunit
Target Background
This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X.
Notification