-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRAME was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PRAME (NP_006106.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRAME was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PRAME (NP_006106.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10207A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRAME |
| Target Synonyms | MAPE; OIP4; CT130; OIP-4; PRAME | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung, Rat lung, U-251MG, U2OS | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PRAME (NP_006106.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVK | Uniprot ID | P78395 |
Uniprot Id
P78395
Target Species
Human
Target Name
PRAME
Target Full Name
Melanoma antigen preferentially expressed in tumors
Target Function
Substrate-recognition component of a Cul2-RING (CRL2) E3 ubiquitin-protein ligase complex, which mediates ubiquitination of target proteins, leading to their degradation. The CRL2(PRAME) complex mediates ubiquitination and degradation of truncated MSRB1/SEPX1 selenoproteins produced by failed UGA/Sec decoding. In the nucleus, the CRL2(PRAME) complex is recruited to epigenetically and transcriptionally active promoter regions bound by nuclear transcription factor Y (NFY) and probably plays a role in chromstin regulation. Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG: prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm. Golgi apparatus. Cell membrane.
Target Protein Families
PRAME family
Target Tissue Specificity
Expressed in testis. Detected in samples of kidney, brain and skin.
Target Research Area
Apoptosis
Target Synonyms
4930534P07Rik; Cancer/testis antigen 130; CT130; MAPE; Melanoma antigen preferentially expressed in tumors; OIP 4; OIP-4; OIP4 ; OPA interacting protein 4; Opa interacting protein OIP4; OPA-interacting protein 4; PRAME; PRAME_HUMAN; Preferentially expressed antigen in melanoma ; Preferentially expressed antigen of melanoma; RP23-250F8.3
Target Background
This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants.
Notification