-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRDM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-210 of human PRDM1 (NP_001189.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PRDM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-210 of human PRDM1 (NP_001189.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04446A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRDM1 |
| Target Synonyms | BLIMP1; PRDI-BF1; PRDM1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-210 of human PRDM1 (NP_001189.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHY | Uniprot ID | O75626 |
Uniprot Id
O75626
Target Species
Human
Target Name
PRDM1
Target Full Name
PR domain zinc finger protein 1
Target Function
Transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T cell types such as tissue-resident memory T (Trm), natural killer (trNK) and natural killer T (NKT) cells and negatively regulates gene expression of proteins that promote the egress of tissue-resident T-cell populations from non-lymphoid organs. Plays a role in the development, retention and long-term establishment of adaptive and innate tissue-resident lymphocyte T cell types in non-lymphoid organs, such as the skin and gut, but also in other nonbarrier tissues like liver and kidney, and therefore may provide immediate immunological protection against reactivating infections or viral reinfection. Binds specifically to the PRDI element in the promoter of the beta-interferon gene. Drives the maturation of B-lymphocytes into Ig secreting cells. Associates with the transcriptional repressor ZNF683 to chromatin at gene promoter regions.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily
Target Synonyms
B Lymphocyte Induced Maturation Protein 1; Beta interferon gene positive regulatory domain I binding factor; Beta-interferon gene positive regulatory domain I-binding factor; BLIMP-1; BLIMP1; Positive Regulatory Domain I Binding Factor 1; Positive regulatory domain I-binding factor 1; PR Domain Containing 1; PR domain containing 1 with ZNF domain; PR domain containing 1 with ZNF domain isoform 2; PR domain containing protein 1; PR domain zinc finger protein 1; PR domain-containing protein 1; PRDI BF1; PRDI binding factor 1; PRDI-BF1; PRDI-binding factor 1; PRDM 1; Prdm1; PRDM1_HUMAN
Target Background
This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported.
Notification