-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRDM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-176 of human PRDM2 (NP_036363.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRDM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-176 of human PRDM2 (NP_036363.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09587A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRDM2 |
| Target Synonyms | RIZ; KMT8; RIZ1; RIZ2; KMT8A; MTB-ZF; HUMHOXY1; PRDM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, LO2, MCF7, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-176 of human PRDM2 (NP_036363.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQ | Uniprot ID | Q13029 |
Uniprot Id
Q13029
Target Species
Human
Target Name
PRDM2
Target Full Name
PR domain zinc finger protein 2
Target Function
S-adenosyl-L-methionine-dependent histone methyltransferase that specifically methylates 'Lys-9' of histone H3. May function as a DNA-binding transcription factor. Binds to the macrophage-specific TPA-responsive element (MTE) of the HMOX1 (heme oxygenase 1) gene and may act as a transcriptional activator of this gene.
Target Subcellular Location
Nucleus.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily
Target Tissue Specificity
Highly expressed in retinoblastoma cell lines and in brain tumors. Also expressed in a number of other cell lines and in brain, heart, skeletal muscle, liver and spleen. Isoform 1 is expressed in testis at much higher level than isoform 3.
Target Synonyms
GATA-3-binding protein G3B; HUMHOXY1; KMT8; Lysine N-methyltransferase 8; MTB-ZF; MTE-binding protein; PR domain containing 2; with ZNF domain; PR domain zinc finger protein 2; PR domain-containing protein 2; PRDM2; PRDM2_HUMAN; Retinoblastoma protein binding zinc finger protein; Retinoblastoma protein-interacting zinc finger protein; Retinoblastoma protein-interacting zinc-finger protein; RIZ; RIZ1; RIZ2; Zinc finger DNA binding protein; Zinc finger protein RIZ
Target Background
This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification