Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRDM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PRDM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02556A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRDM5 |
| Target Synonyms | BCS2; PFM2; PRDM5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse lung, Mouse ovary, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQ | Uniprot ID | Q9NQX1 |
Uniprot Id
Q9NQX1
Target Species
Human
Target Name
PRDM5
Target Full Name
PR domain zinc finger protein 5
Target Function
Sequence-specific DNA-binding transcription factor. Represses transcription at least in part by recruitment of the histone methyltransferase EHMT2/G9A and histone deacetylases such as HDAC1. Regulates hematopoiesis-associated protein-coding and microRNA (miRNA) genes. May regulate the expression of proteins involved in extracellular matrix development and maintenance, including fibrillar collagens, such as COL4A1 and COL11A1, connective tissue components, such as HAPLN1, and molecules regulating cell migration and adhesion, including EDIL3 and TGFB2. May cause G2/M arrest and apoptosis in cancer cells.
Target Involvement
Brittle cornea syndrome 2 (BCS2)
Target Subcellular Location
Nucleus.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily
Target Tissue Specificity
Widely expressed with highest levels in colon and ovary. Tends to be silenced in breast, colorectal, gastric and liver cancer tissues.
Target Synonyms
BCS2; PFM 2; PFM2; PR domain containing 5; PR domain containing protein 5; PR domain zinc finger protein 5; PR domain-containing protein 5; PRDM 5; PRDM5; PRDM5 protein; PRDM5_HUMAN
Target Background
The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
