Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRDM7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-310 of human PRDM7 (NP_001091643.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PRDM7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-310 of human PRDM7 (NP_001091643.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01851A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRDM7 |
| Target Synonyms | PFM4; ZNF910; PRDM7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BT-474, HepG2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-310 of human PRDM7 (NP_001091643.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRNCYEYVDGKDK | Uniprot ID | Q9NQW5 |
Uniprot Id
Q9NQW5
Target Species
Human
Target Name
PRDM7
Target Full Name
Histone-lysine N-methyltransferase PRDM7
Target Function
Histone methyltransferase that selectively methylates 'Lys-4' of dimethylated histone H3 (H3K4me2) to produce trimethylated 'Lys-4' histone H3 (H3K4me3). May play a role in epigenetic regulation of gene expression by defining an active chromatin state.
Target Subcellular Location
Nucleus. Chromosome.
Target Research Area
Others
Target Synonyms
PRDM7; PFM4Probable histone-lysine N-methyltransferase PRDM7; EC 2.1.1.-; PR domain zinc finger protein 7; PR domain-containing protein 7
Target Background
This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and may function as a histone methyltransferase.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
