-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRDX1/PRDX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human PRDX1/PRDX2 (NP_859428.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against PRDX1/PRDX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human PRDX1/PRDX2 (NP_859428.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-07188A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRDX1/PRDX2 |
| Target Synonyms | PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a; PRDX1/PRDX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human PRDX1/PRDX2 (NP_859428.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWYEQGPKREVAAKLTPSGPSSVASWPLLNLWNLRFPIVKIMETLPPKSLRMMTVISI | Uniprot ID | P32119 |
Uniprot Id
P32119
Target Species
Human
Target Name
PRDX2
Target Full Name
Peroxiredoxin-2
Target Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peroxiredoxin family, AhpC/Prx1 subfamily
Target Research Area
Neuroscience
Target Synonyms
Epididymis secretory sperm binding protein Li 2a; HEL S 2a; MGC4104; Natural killer cell enhancing factor B; Natural killer cell-enhancing factor B; Natural Killer Enhancing Factor B; NKEF B; NKEF-B; NKEFB; Peroxiredoxin 2; Peroxiredoxin-2; PRDX 2; PRDX2; PRDX2_HUMAN; PrP; PRX2; PRXII; PTX1; TDPX1; Thiol Specific Antioxidant 1 ; Thiol specific antioxidant protein; Thiol-specific antioxidant protein; Thioredoxin Dependent Peroxide Reductase 1; Thioredoxin peroxidase 1; Thioredoxin-dependent peroxide reductase 1; Torin; TPX1; TSA
Target Background
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13.
Notification