Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKACG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRKACG (NP_002723.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRKACG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRKACG (NP_002723.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05575A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKACG |
| Target Synonyms | KAPG; PKACg; BDPLT19; PRKACG | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, SKOV3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRKACG (NP_002723.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAID | Uniprot ID | P22612 |
Uniprot Id
P22612
Target Species
Human
Target Name
PRKACG
Target Full Name
cAMP-dependent protein kinase catalytic subunit gamma
Target Function
Phosphorylates a large number of substrates in the cytoplasm and the nucleus.
Target Involvement
Bleeding disorder, platelet-type 19 (BDPLT19)
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily
Target Tissue Specificity
Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.
Target Synonyms
cAMP-dependent protein kinase catalytic subunit gamma; KAPCG_HUMAN; KAPG ; PKA C gamma; PKA C-gamma; PKACg; PRKACG; Protein kinase cAMP dependent catalytic gamma; Serine (threonine) protein kinase
Target Background
Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
