-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKAR1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-386 of human PRKAR1A (NP_002725.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PRKAR1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-386 of human PRKAR1A (NP_002725.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07647A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKAR1A |
| Target Synonyms | CAR; CNC; CNC1; PKR1; TSE1; ADOHR; PPNAD1; PRKAR1; ACRDYS1; PRKAR1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-386 of human PRKAR1A (NP_002725.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV | Uniprot ID | P10644 |
Uniprot Id
P10644
Target Species
Human
Target Name
PRKAR1A
Target Full Name
cAMP-dependent protein kinase type I-alpha regulatory subunit
Target Function
Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.
Target Involvement
Carney complex 1 (CNC1); Intracardiac myxoma (INTMYX); Primary pigmented nodular adrenocortical disease 1 (PPNAD1); Acrodysostosis 1, with or without hormone resistance (ACRDYS1)
Target Subcellular Location
Cell membrane.
Target Protein Families
CAMP-dependent kinase regulatory chain family
Target Tissue Specificity
Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
Target Synonyms
ACRDYS1; ADOHR; cAMP dependent protein kinase regulatory subunit alpha 1; cAMP dependent protein kinase regulatory subunit RIalpha; cAMP dependent protein kinase type I alpha regulatory chain; cAMP dependent protein kinase type I alpha regulatory subunit; cAMP-dependent protein kinase type I-alpha regulatory subunit; CAR; Carney complex type 1; CNC 1; CNC; CNC1; DKFZp779L0468; KAP0_HUMAN; MGC17251; PKA RIA ; PKR 1; PKR1; PPNAD 1; PPNAD1; PRKAR 1; PRKAR1; PRKAR1A; PRKAR1A/RARA FUSION GENE; Protein kinase A type 1a regulatory subunit; Protein kinase cAMP dependent regulatory type I alpha; PTC2 CHIMERIC ONCOGENE; INCLUDED; Tissue specific extinguisher 1; Tissue-specific extinguisher 1; TSE 1; TSE1
Target Background
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Several alternatively spliced transcript variants encoding two different isoforms have been observed.
Notification