-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRKD3 (NP_005804.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRKD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRKD3 (NP_005804.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09382A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKD3 |
| Target Synonyms | EPK2; PKD3; PRKCN; PKC-NU; nPKC-NU; PRKD3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse ovary, NCI-H460, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRKD3 (NP_005804.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPEC | Uniprot ID | O94806 |
Uniprot Id
O94806
Target Species
Human
Target Name
PRKD3
Target Full Name
Serine/threonine-protein kinase D3
Target Function
Converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. Involved in resistance to oxidative stress.
Target Subcellular Location
Cytoplasm. Membrane. Note=Translocation to the cell membrane is required for kinase activation.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, PKD subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
EPK 2; EPK2; KPCD3_HUMAN; nPKC nu; nPKC-nu; nPKCnu; nu; PKCnu; PKD 3; PKD3; PRK D3; PRKCN; PRKD 3; Prkd3; Protein kinase C; Protein kinase C nu; Protein kinase C nu type; Protein kinase D3; Protein kinase EPK 2; Protein kinase EPK2; Serine threonine protein kinase; Serine/threonine protein kinase D3; Serine/threonine-protein kinase D3
Target Background
This gene belongs to the multigene protein kinase D family of serine/threonine kinases, which bind diacylglycerol and phorbol esters. Members of this family are characterized by an N-terminal regulatory domain comprised of a tandem repeat of cysteine-rich zinc-finger motifs and a pleckstrin domain. The C-terminal region contains the catalytic domain and is distantly related to calcium-regulated kinases. Catalytic activity of this enzyme promotes its nuclear localization. This protein has been implicated in a variety of functions including negative regulation of human airway epithelial barrier formation, growth regulation of breast and prostate cancer cells, and vesicle trafficking.
Notification