-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human PRKG2 (NP_006250.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against PRKG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human PRKG2 (NP_006250.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-04298A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKG2 |
| Target Synonyms | AMD4; PKG2; SMDP; cGK2; cGKII; PRKGR2; PRKG2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse lung | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human PRKG2 (NP_006250.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLIT | Uniprot ID | Q13237 |
Uniprot Id
Q13237
Target Species
Human
Target Name
PRKG2
Target Full Name
cGMP-dependent protein kinase 2
Target Function
Crucial regulator of intestinal secretion and bone growth. Phosphorylates and activates CFTR on the plasma membrane. Plays a key role in intestinal secretion by regulating cGMP-dependent translocation of CFTR in jejunum. Acts downstream of NMDAR to activate the plasma membrane accumulation of GRIA1/GLUR1 in synapse and increase synaptic plasticity. Phosphorylates GRIA1/GLUR1 at Ser-863. Acts as regulator of gene expression and activator of the extracellular signal-regulated kinases MAPK3/ERK1 and MAPK1/ERK2 in mechanically stimulated osteoblasts. Under fluid shear stress, mediates ERK activation and subsequent induction of FOS, FOSL1/FRA1, FOSL2/FRA2 and FOSB that play a key role in the osteoblast anabolic response to mechanical stimulation.
Target Subcellular Location
Apical cell membrane; Lipid-anchor.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, cGMP subfamily
Target Tissue Specificity
Highly concentrated in brain, lung and intestinal mucosa.
Target Synonyms
CGK 2; cGK2; cGKII; cGMP dependent protein kinase 2; cGMP-dependent protein kinase 2; cGMP-dependent protein kinase II; KGP2_HUMAN; PRKG 2; PRKG2; PRKGR2; Protein kinase; cGMP dependent; type II; Type II cGMP dependent protein kinase
Target Background
This gene encodes a protein that belongs to the serine/threonine protein kinase family of proteins. The encoded protein binds to and inhibits the activation of several receptor tyrosine kinases. The membrane-bound protein is a regulator of intestinal secretion, bone growth and renin secretion. Alternate splicing results in multiple transcript variants encoding distinct isoforms whose regulatory N-termini differ in length but whose C-terminal catalytic domains are identical.
Notification