-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKRA/PACT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PRKRA/PACT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13985A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKRA/PACT |
| Target Synonyms | RAX; PACT; DYT16; HSD14; PRKRA/PACT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse testis, PC-12 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAHNALQYLKIIAERK | Uniprot ID | O75569 |
Uniprot Id
O75569
Target Species
Human
Target Name
PRKRA
Target Full Name
Interferon-inducible double-stranded RNA-dependent protein kinase activator A
Target Function
Activates EIF2AK2/PKR in the absence of double-stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by DICER1 and for subsequent siRNA-mediated post-transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1. Promotes UBC9-p53/TP53 association and sumoylation and phosphorylation of p53/TP53 at 'Lys-386' at 'Ser-392' respectively and enhances its activity in a EIF2AK2/PKR-dependent manner.
Target Involvement
Dystonia 16 (DYT16)
Target Subcellular Location
Cytoplasm, perinuclear region. Cytoplasm.
Target Protein Families
PRKRA family
Target Synonyms
DYT16; HSD14; Interferon inducible double stranded RNA dependent protein kinase activator A; interferon-inducible double stranded RNA-dependent activator; Interferon-inducible double stranded RNA-dependent protein kinase activator A; PACT; PKR associated protein X; PKR associating protein X; PKR-associated protein X; PKR-associating protein X; PRKRA; PRKRA_HUMAN; Protein activator of the interferon induced protein kinase; Protein activator of the interferon-induced protein kinase; Protein kinase; Protein kinase interferon inducible double stranded RNA dependent activator; RAX
Target Background
This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants.
Notification