-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 239-358 of human PRKX (NP_005035.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRKX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 239-358 of human PRKX (NP_005035.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05151A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKX |
| Target Synonyms | PKX1; PRKX | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 239-358 of human PRKX (NP_005035.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF | Uniprot ID | P51817 |
Uniprot Id
P51817
Target Species
Human
Target Name
PRKX
Target Full Name
cAMP-dependent protein kinase catalytic subunit PRKX
Target Function
Serine/threonine protein kinase regulated by and mediating cAMP signaling in cells. Acts through phosphorylation of downstream targets that may include CREB, SMAD6 and PKD1 and has multiple functions in cellular differentiation and epithelial morphogenesis. Regulates myeloid cell differentiation through SMAD6 phosphorylation. Involved in nephrogenesis by stimulating renal epithelial cell migration and tubulogenesis. Also involved in angiogenesis through stimulation of endothelial cell proliferation, migration and vascular-like structure formation.
Target Involvement
A chromosomal aberration involving PRKX is a cause of sex reversal disorder. Translocation t(X;Y)(p22;p11) with PRKY. Chromosomal translocations proximal to PRKY account for about 30% of the cases of sex reversal disorder in XX males and XY females.
Target Subcellular Location
Cytoplasm. Nucleus. Note=cAMP induces nuclear translocation.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily
Target Tissue Specificity
Widely expressed (at protein level). Specifically expressed in blood by macrophages and granulocytes according to PubMed:9860982.
Target Synonyms
PKX1; PRKX; PRKX_HUMAN; Protein kinase PKX1; Serine/threonine-protein kinase PRKX
Target Background
This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein may also be involved in macrophage and granulocyte maturation. Abnormal recombination between this gene and a related pseudogene on chromosome Y is a frequent cause of sex reversal disorder in XX males and XY females. Pseudogenes of this gene are found on chromosomes X, 15 and Y.
Notification