-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRMT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT1 (Q99873) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PRMT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT1 (Q99873) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16066A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRMT1 |
| Target Synonyms | ANM1; HCP1; IR1B4; HRMT1L2; PRMT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, SW620 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT1 (Q99873). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTG | Uniprot ID | Q99873 |
Uniprot Id
Q99873
Target Species
Human
Target Name
PRMT1
Target Full Name
Protein arginine N-methyltransferase 1
Target Function
Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, ILF3, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15, EWS, HABP4 and SERBP1. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway. Methylates RBM15, promoting ubiquitination and degradation of RBM15. Methylates FOXO1 and retains it in the nucleus increasing its transcriptional activity. Methylates CHTOP and this methylation is critical for its 5-hydroxymethylcytosine (5hmC)-binding activity. Methylates H4R3 in genes involved in glioblastomagenesis in a CHTOP- and/or TET1-dependent manner. Plays a role in regulating alternative splicing in the heart.
Target Subcellular Location
Nucleus. Nucleus, nucleoplasm. Cytoplasm. Cytoplasm, cytosol.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family
Target Tissue Specificity
Widely expressed. Expressed strongly in colorectal cancer cells (at protein level). Expressed strongly in colorectal cancer tissues compared to wild-type colon samples (at protein level). Expressed strongly in colorectal cancer tissues compared to wild-ty
Target Synonyms
ANM1; HCP1; IR1B4; HRMT1L2; PRMT1
Target Background
This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5.
Notification