-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRMT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PRMT6 (Q96LA8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRMT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PRMT6 (Q96LA8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16097A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRMT6 |
| Target Synonyms | HRMT1L6; PRMT6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Jurkat, MCF7, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PRMT6 (Q96LA8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE | Uniprot ID | Q96LA8 |
Uniprot Id
Q96LA8
Target Species
Human
Target Name
PRMT6
Target Full Name
Protein arginine N-methyltransferase 6
Target Function
Arginine methyltransferase that can catalyze the formation of both omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA), with a strong preference for the formation of aDMA. Preferentially methylates arginyl residues present in a glycine and arginine-rich domain and displays preference for monomethylated substrates. Specifically mediates the asymmetric dimethylation of histone H3 'Arg-2' to form H3R2me2a. H3R2me2a represents a specific tag for epigenetic transcriptional repression and is mutually exclusive with methylation on histone H3 'Lys-4' (H3K4me2 and H3K4me3). Acts as a transcriptional repressor of various genes such as HOXA2, THBS1 and TP53. Repression of TP53 blocks cellular senescence. Also methylates histone H2A and H4 'Arg-3' (H2AR3me and H4R3me, respectively). Acts as a regulator of DNA base excision during DNA repair by mediating the methylation of DNA polymerase beta (POLB), leading to the stimulation of its polymerase activity by enhancing DNA binding and processivity. Methylates HMGA1. Regulates alternative splicing events. Acts as a transcriptional coactivator of a number of steroid hormone receptors including ESR1, ESR2, PGR and NR3C1. Promotes fasting-induced transcriptional activation of the gluconeogenic program through methylation of the CRTC2 transcription coactivator. May play a role in innate immunity against HIV-1 in case of infection by methylating and impairing the function of various HIV-1 proteins such as Tat, Rev and Nucleocapsid protein p7 (NC). Methylates GPS2, protecting GPS2 from ubiquitination and degradation. Methylates SIRT7, inhibiting SIRT7 histone deacetylase activity and promoting mitochondria biogenesis.
Target Subcellular Location
Nucleus.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family, PRMT6 subfamily
Target Tissue Specificity
Highly expressed in kidney and testis.
Target Synonyms
ANM6_HUMAN; Chromobox protein homolog 7; FLJ10559; FLJ51477; Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 6; Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6; Histone-arginine N-methyltransferase PRMT6; HMT1 hnRNP methyltransferase like 6.; HRMT1L6; OTTHUMP00000012633; PRMT 6; prmt6; Protein arginine methyltransferase 6; Protein arginine N methyltransferase 6; Protein arginine N-methyltransferase 6
Target Background
The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity.
Notification