-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Pro-glucagon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-89 of human Pro-glucagon (NP_002045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Pro-glucagon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-89 of human Pro-glucagon (NP_002045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11417A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pro-glucagon |
| Target Synonyms | GLP1; GLP2; GRPP; GLP-1; Pro-glucagon | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BxPC-3, Rat spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-89 of human Pro-glucagon (NP_002045.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA | Uniprot ID | P01275 |
Uniprot Id
P01275
Target Species
Human
Target Name
GCG
Target Full Name
Pro-glucagon
Target Function
Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.; Potent stimulator of glucose-dependent insulin release. Also stimulates insulin release in response to IL6. Plays important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Has growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis.; Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.; Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.; May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
Target Subcellular Location
Secreted.; [Glucagon-like peptide 1]: Secreted.
Target Protein Families
Glucagon family
Target Tissue Specificity
[Glucagon]: Secreted in the A cells of the islets of Langerhans.; [Glucagon-like peptide 1]: Secreted in the A cells of the islets of Langerhans. Secreted from enteroendocrine L cells throughout the gastrointestinal tract. Also secreted in selected neuron
Target Research Area
Cancer
Target Synonyms
GCG; Glicentin related polypeptide; glicentin-related polypeptide; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP-2; GLP1; GLP1; included; GLP2; GLP2; included; GLUC_HUMAN; Glucagon; Glucagon like peptide 1; glucagon-like peptide 1; Glucagon-like peptide 1; included; Glucagon-like peptide 2; Glucagon-like peptide 2; included; GRPP; OXM; OXY; preproglucagon
Target Background
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Notification