-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Progesterone Receptor was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Progesterone Receptor was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15963A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Progesterone Receptor |
| Target Synonyms | PR; NR3C3; Progesterone Receptor | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | T-47D | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD | Uniprot ID | P06401 |
Uniprot Id
P06401
Target Species
Human
Target Name
PGR
Target Full Name
Progesterone receptor
Target Function
The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as transcriptional activator or repressor.; Ligand-dependent transdominant repressor of steroid hormone receptor transcriptional activity including repression of its isoform B, MR and ER. Transrepressional activity may involve recruitment of corepressor NCOR2.; Transcriptional activator of several progesteron-dependent promoters in a variety of cell types. Involved in activation of SRC-dependent MAPK signaling on hormone stimulation.; Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Nucleoplasmic shuttling is both hormone- and cell cycle-dependent. On hormone stimulation, retained in the cytoplasm in the G(1) and G(2)/M phases.; [Isoform A]: Nucleus. Cytoplasm. Note=Mainly nuclear.; [Isoform 4]: Mitochondrion outer membrane.
Target Protein Families
Nuclear hormone receptor family, NR3 subfamily
Target Tissue Specificity
In reproductive tissues the expression of isoform A and isoform B varies as a consequence of developmental and hormonal status. Isoform A and isoform B are expressed in comparable levels in uterine glandular epithelium during the proliferative phase of th
Target Synonyms
PR; NR3C3; Progesterone Receptor
Target Background
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap.
Notification