-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Prohibitin 2 (PHB2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (Q99623) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Prohibitin 2 (PHB2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (Q99623) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-14014A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Prohibitin 2 (PHB2) |
| Target Synonyms | BAP; REA; p22; hBAP; Bap37; BCAP37; PNAS-141; Prohibitin 2 (PHB2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Mouse heart, NIH/3T3, HT-1080, Mouse liver, SKOV3 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (Q99623). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK | Uniprot ID | Q99623 |
Uniprot Id
Q99623
Target Species
Human
Target Name
PHB2
Target Full Name
Prohibitin-2
Target Function
Protein with pleiotropic attributes mediated in a cell-compartment- and tissue-specific manner, which include the plasma membrane-associated cell signaling functions, mitochondrial chaperone, and transcriptional co-regulator of transcription factors and sex steroid hormones in the nucleus.; In the mitochondria, together with PHB, forms large ring complexes (prohibitin complexes) in the inner mitochondrial membrane (IMM) and functions as chaperone protein that stabilizes mitochondrial respiratory enzymes and maintains mitochondrial integrity in the IMM, which is required for mitochondrial morphogenesis, neuronal survival, and normal lifespan (Probable). The prohibitin complex, with DNAJC19, regulates cardiolipin remodeling and the protein turnover of OMA1 in a cardiolipin-binding manner. Also regulates cytochrome-c oxidase assembly (COX) and mitochondrial respiration. Binding to sphingoid 1-phosphate (SPP) modulates its regulator activity. Has a key role of mitophagy receptor involved in targeting mitochondria for autophagic degradation. Involved in mitochondrial-mediated antiviral innate immunity, activates DDX58/RIG-I-mediated signal transduction and production of IFNB1 and proinflammatory cytokine IL6.; In the nucleus, serves as transcriptional co-regulator (Probable). Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity.; In the plasma membrane, is involved in IGFBP6-induced cell migration. Cooperates with CD86 to mediate CD86-signaling in B lymphocytes that regulates the level of IgG1 produced through the activation of distal signaling intermediates. Upon CD40 engagement, required to activate NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation.; (Microbial infection) Involved in human enterovirus 71/EV-71 infection by enhancing the autophagy mechanism during the infection.
Target Subcellular Location
Mitochondrion inner membrane. Cytoplasm. Nucleus. Cell membrane.; [Isoform 1]: Mitochondrion inner membrane.; [Isoform 2]: Mitochondrion inner membrane.
Target Protein Families
Prohibitin family
Target Research Area
Signal Transduction
Target Synonyms
B cell receptor associated protein BAP37; B-cell receptor-associated protein BAP37; BAP; Bap37; BCAP 37; D prohibitin; D-prohibitin; p22; Phb2; PHB2_HUMAN; PNAS 141; Prohibitin 2; Prohibitin-2; Repressor of estrogen receptor activity
Target Background
Enables several functions, including protein C-terminus binding activity; protein N-terminus binding activity; and protein dimerization activity. Involved in several processes, including defense response to virus; positive regulation of cell cycle phase transition; and regulation of transcription, DNA-templated. Located in several cellular components, including cell surface; mitochondrial membrane; and nuclear matrix. Part of mitochondrial prohibitin complex.
Notification