-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PROK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human PROK1 (P58294) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PROK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human PROK1 (P58294) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14356A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PROK1 |
| Target Synonyms | PK1; PRK1; EGVEGF; PROK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, HepG2, Mouse liver, Rat kidney, Rat ovary | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human PROK1 (P58294). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF | Uniprot ID | P58294 |
Uniprot Id
P58294
Target Species
Human
Target Name
PROK1
Target Full Name
Prokineticin-1
Target Function
Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis.
Target Subcellular Location
Secreted.
Target Protein Families
AVIT (prokineticin) family
Target Tissue Specificity
Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic glands, ovary, testi
Target Synonyms
Black mamba toxin related protein; EG VEGF; EG-VEGF; EGVEGF; Endocrine-gland-derived vascular endothelial growth factor; Mambakine; PK1; PRK1; PROK1; PROK1_HUMAN; Prokineticin 1; Prokineticin-1
Target Background
The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and non-endothelial cell types. Its expression is restricted to the steroidogenic glands (ovary, testis, adrenal, and placenta), is induced by hypoxia, and often complementary to the expression of vascular endothelial growth factor (VEGF), suggesting that these molecules function in a coordinated manner.
Notification