Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PROKR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human PROKR2 (NP_658986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PROKR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human PROKR2 (NP_658986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04226A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PROKR2 |
| Target Synonyms | HH3; KAL3; PKR2; GPRg2; GPR73b; GPR73L1; dJ680N4.3; PROKR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse thymus, SKOV3, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human PROKR2 (NP_658986.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL | Uniprot ID | Q8NFJ6 |
Uniprot Id
Q8NFJ6
Target Species
Human
Target Name
PROKR2
Target Full Name
Prokineticin receptor 2
Target Function
Receptor for prokineticin 2. Exclusively coupled to the G(q) subclass of heteromeric G proteins. Activation leads to mobilization of calcium, stimulation of phosphoinositide turnover and activation of p44/p42 mitogen-activated protein kinase.
Target Involvement
Hypogonadotropic hypogonadism 3 with or without anosmia (HH3)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in the ileocecum, thyroid gland, pituitary gland, salivary gland, adrenal gland, testis, ovary and brain.
Target Synonyms
PROKR2; GPR73L1; PKR2; Prokineticin receptor 2; PK-R2; G-protein coupled receptor 73-like 1; G-protein coupled receptor I5E; GPR73b; GPRg2
Target Background
Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded protein is similar in sequence to GPR73, another G protein-coupled receptor for prokineticins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
