-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Prolyl hydroxylase PHD1 (EGLN2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolyl hydroxylase PHD1 (EGLN2) (Q96KS0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Prolyl hydroxylase PHD1 (EGLN2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolyl hydroxylase PHD1 (EGLN2) (Q96KS0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16584A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Prolyl hydroxylase PHD1 (EGLN2) |
| Target Synonyms | EIT6; PHD1; EIT-6; HPH-1; HPH-3; HIFPH1; HIF-PH1; Prolyl hydroxylase PHD1 (EGLN2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, MCF7, Mouse brain, Mouse lung, Mouse testis, PC-3, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolyl hydroxylase PHD1 (EGLN2) (Q96KS0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALV | Uniprot ID | Q96KS0 |
Uniprot Id
Q96KS0
Target Species
Human
Target Name
EGLN2
Target Full Name
Prolyl hydroxylase EGLN2
Target Function
Prolyl hydroxylase that mediates hydroxylation of proline residues in target proteins, such as ATF4, IKBKB, CEP192 and HIF1A. Target proteins are preferentially recognized via a LXXLAP motif. Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. Links oxygen sensing to cell cycle and primary cilia formation by hydroxylating the critical centrosome component CEP192 which promotes its ubiquitination and subsequent proteasomal degradation. Hydroxylates IKBKB, mediating NF-kappa-B activation in hypoxic conditions. Also mediates hydroxylation of ATF4, leading to decreased protein stability of ATF4.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in adult and fetal heart, brain, liver, lung, skeletal muscle, and kidney. Also expressed in testis and placenta. Highest levels in adult brain, placenta, lung, kidney, and testis. Expressed in hormone responsive tissues, including normal and ca
Target Research Area
Cancer
Target Synonyms
DKFZp434E026; EGL nine (C.elegans) homolog 2; Egl nine homolog 2 (C. elegans); Egl nine homolog 2; EGLN 2; EGLN2; EGLN2_HUMAN; EIT 6; EIT6; Estrogen-induced tag 6; HIF P4H 1; HIF PH1; HIF prolyl hydroxylase 1; HIF-PH1; HIF-prolyl hydroxylase 1; HIFPH 1; HIFPH1; HPH 3; HPH-1; HPH-3; HPH3; Hypoxia inducible factor prolyl hydroxylase 1; Hypoxia-inducible factor prolyl hydroxylase 1; P4H1; PHD 1; PhD1; prolyl hydroxylase domain containing protein 1; Prolyl hydroxylase domain-containing protein 1
Target Background
The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.
Notification