Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRPSAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-252 of human PRPSAP2 (NP_001340030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PRPSAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-252 of human PRPSAP2 (NP_001340030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04890A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRPSAP2 |
| Target Synonyms | PAP41; PRPSAP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 211-252 of human PRPSAP2 (NP_001340030.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKP | Uniprot ID | O60256 |
Uniprot Id
O60256
Target Species
Human
Target Name
PRPSAP2
Target Full Name
Phosphoribosyl pyrophosphate synthase-associated protein 2
Target Function
Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.
Target Protein Families
Ribose-phosphate pyrophosphokinase family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
41 kDa phosphoribosypyrophosphate synthetase associated protein; 41 kDa phosphoribosypyrophosphate synthetase-associated protein; KPRB; KPRB_HUMAN; MGC117304; MGC126719; MGC126721; PAP41; Phosphoribosyl pyrophosphate synthase-associated protein 2; Phosphoribosyl pyrophosphate synthetase associated protein 2; PRPP synthase-associated protein 2; PRPP synthetase associated protein 2; Prpsap2
Target Background
This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
