Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRR16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PRR16 (NP_001295016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRR16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PRR16 (NP_001295016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06112A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRR16 |
| Target Synonyms | DSC54; LARGEN; PRR16 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PRR16 (NP_001295016.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PNPPPPPPRLTPVKCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDC | Uniprot ID | Q569H4 |
Uniprot Id
Q569H4
Target Species
Human
Target Name
PRR16
Target Full Name
Protein Largen
Target Function
Regulator of cell size that promotes cell size increase independently of mTOR and Hippo signaling pathways. Acts by stimulating the translation of specific mRNAs, including those encoding proteins affecting mitochondrial functions. Increases mitochondrial mass and respiration.
Target Synonyms
DSC54; LARGN_HUMAN; Mesenchymal stem cell protein DSC54; MGC104614; proline rich protein 16; Proline-rich protein 16; Protein Largen; Prr16
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
