-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRRX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PRRX1 (NP_073207.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRRX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PRRX1 (NP_073207.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10908A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRRX1 |
| Target Synonyms | PMX1; PRX1; AGOTC; PHOX1; PRX-1; PRRX1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PRRX1 (NP_073207.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK | Uniprot ID | P54821 |
Uniprot Id
P54821
Target Species
Human
Target Name
PRRX1
Target Full Name
Paired mesoderm homeobox protein 1
Target Function
Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.
Target Involvement
Agnathia-otocephaly complex (AGOTC)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Synonyms
AGOTC; Homeobox protein PHOX1; Paired mesoderm homeo box 1; Paired mesoderm homeobox 1; paired mesoderm homeobox 1 isoform pmx-1b; Paired mesoderm homeobox protein 1; Paired related homeobox 1; Paired related homeobox protein 1; Paired-related homeobox protein 1; PHOX 1; PHOX1 1, 2; PHOX1; PMX 1; PMX1; PRRX 1; Prrx1; PRRX1_HUMAN; PRX 1 ; PRX-1; PRX1
Target Background
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.
Notification