Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRSS23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human PRSS23 (NP_009104.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PRSS23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human PRSS23 (NP_009104.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11427A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRSS23 |
| Target Synonyms | SIG13; SPUVE; ZSIG13; PRSS23 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse lung, Mouse spleen, Rat kidney, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human PRSS23 (NP_009104.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSI | Uniprot ID | O95084 |
Uniprot Id
O95084
Target Species
Human
Target Name
PRSS23
Target Full Name
Serine protease 23
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase S1 family
Target Research Area
Signal Transduction
Target Synonyms
Protease serine 23; PRS23_HUMAN; Prss23; Putative secreted protein ZSIG13; Serine protease 23; Serine protease umbilical endothelium; SIG13; SPUVE; UNQ270/PRO307; ZSIG13
Target Background
This gene encodes a conserved member of the trypsin family of serine proteases. Mouse studies found a decrease of mRNA levels of this gene after ovulation was induced. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
